Lineage for d4gp8b1 (4gp8 B:3-40)

  1. Root: SCOPe 2.04
  2. 1695624Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1697026Fold f.17: Transmembrane helix hairpin [81334] (5 superfamilies)
    two antiparallel transmembrane helices
  4. 1697048Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (2 families) (S)
  5. 1697049Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (5 proteins)
  6. 1697069Protein Bacterial ba3 type cytochrome c oxidase subunit II [81460] (1 species)
  7. 1697070Species Thermus thermophilus [TaxId:274] [81459] (19 PDB entries)
    the "missing" first helix is complemented by the ba3 subunit IIa
  8. 1697078Domain d4gp8b1: 4gp8 B:3-40 [222070]
    Other proteins in same PDB: d4gp8a_, d4gp8b2, d4gp8c_
    automated match to d1ehkb2
    complexed with cu, cua, has, hem, olc, per; mutant

Details for d4gp8b1

PDB Entry: 4gp8 (more details), 2.8 Å

PDB Description: Structure of Recombinant Cytochrome ba3 Oxidase mutant Y133W+T231F from Thermus thermophilus
PDB Compounds: (B:) Cytochrome c oxidase subunit 2

SCOPe Domain Sequences for d4gp8b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gp8b1 f.17.2.1 (B:3-40) Bacterial ba3 type cytochrome c oxidase subunit II {Thermus thermophilus [TaxId: 274]}
dehkahkailayekgwlafslamlfvfialiaytlath

SCOPe Domain Coordinates for d4gp8b1:

Click to download the PDB-style file with coordinates for d4gp8b1.
(The format of our PDB-style files is described here.)

Timeline for d4gp8b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4gp8b2