SCOPe 2.04: Domain d4gp8b1: 4gp8 B:3-40

Lineage for d4gp8b1 (4gp8 B:3-40)

1. Root: SCOPe 2.04

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.17: Transmembrane helix hairpin [81334] (5 superfamilies)
   two antiparallel transmembrane helices

4. Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (2 families)

5. Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (5 proteins)

6. Protein Bacterial ba3 type cytochrome c oxidase subunit II [81460] (1 species)

7. Species Thermus thermophilus [TaxId:274] [81459] (19 PDB entries)
   the "missing" first helix is complemented by the ba3 subunit IIa

8. Domain d4gp8b1: 4gp8 B:3-40 [222070]
   Other proteins in same PDB: d4gp8a_, d4gp8b2, d4gp8c_
   automated match to d1ehkb2
   complexed with cu, cua, has, hem, olc, per; mutant

Details for d4gp8b1

PDB Entry: 4gp8, 2.8 Å

PDB Description: Structure of Recombinant Cytochrome ba3 Oxidase mutant Y133W+T231F from Thermus thermophilus

PDB Compounds: (B:) Cytochrome c oxidase subunit 2

SCOPe Domain Sequences for d4gp8b1:

Sequence; same for both SEQRES and ATOM records:

>d4gp8b1 f.17.2.1 (B:3-40) Bacterial ba3 type cytochrome c oxidase subunit II {Thermus thermophilus [TaxId: 274]}
dehkahkailayekgwlafslamlfvfialiaytlath

Timeline for d4gp8b1:

• d4gp8b1 first appeared in SCOPe 2.03
  
• d4gp8b1 appears in SCOPe 2.05
  
• d4gp8b1 appears in the current release, SCOPe 2.08