SCOPe 2.06: Domain d4gokb_: 4gok B:

Lineage for d4gokb_ (4gok B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein ADP-ribosylation factor [52614] (16 species)

7. Species Mouse (Mus musculus), ARL2 [TaxId:10090] [75203] (5 PDB entries)

8. Domain d4gokb_: 4gok B: [222060]
   automated match to d2rhda_
   complexed with gnp, mg

Details for d4gokb_

PDB Entry: 4gok, 2.6 Å

PDB Description: The Crystal structure of Arl2GppNHp in complex with UNC119a

PDB Compounds: (B:) ADP-ribosylation factor-like protein 2

SCOPe Domain Sequences for d4gokb_:

Sequence, based on SEQRES records:

>d4gokb_ c.37.1.8 (B:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]}
lrllmlgldnagkttilkkfngedvdtisptlgfniktlehrgfklniwdvgglkslrsy
wrnyfestdgliwvvdsadrqrmqdcqrelqsllveerlagatllifankqdlpgalscn
aiqealeldsirshhwriqgcsavtgedllpgidwllddissr

Sequence, based on observed residues (ATOM records):

>d4gokb_ c.37.1.8 (B:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]}
lrllmlgldnagkttilkkftisptlgfniktlehrgfklniwdvgglkslrsywrnyfe
stdgliwvvdsadrqrmqdcqrelqsllveerlagatllifankqdlpgalscnaiqeal
eldsirshhwriqgcsavtgedllpgidwllddissr

Timeline for d4gokb_:

• d4gokb_ first appeared in SCOPe 2.03
  
• d4gokb_ appears in SCOPe 2.05
  
• d4gokb_ appears in SCOPe 2.07
  
• d4gokb_ appears in the current release, SCOPe 2.08