Lineage for d4goka_ (4gok A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2124192Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2124193Protein ADP-ribosylation factor [52614] (16 species)
  7. 2124263Species Mouse (Mus musculus), ARL2 [TaxId:10090] [75203] (5 PDB entries)
  8. 2124268Domain d4goka_: 4gok A: [222059]
    automated match to d2rhda_
    complexed with gnp, mg

Details for d4goka_

PDB Entry: 4gok (more details), 2.6 Å

PDB Description: The Crystal structure of Arl2GppNHp in complex with UNC119a
PDB Compounds: (A:) ADP-ribosylation factor-like protein 2

SCOPe Domain Sequences for d4goka_:

Sequence, based on SEQRES records: (download)

>d4goka_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]}
lrllmlgldnagkttilkkfngedvdtisptlgfniktlehrgfklniwdvgglkslrsy
wrnyfestdgliwvvdsadrqrmqdcqrelqsllveerlagatllifankqdlpgalscn
aiqealeldsirshhwriqgcsavtgedllpgidwllddissr

Sequence, based on observed residues (ATOM records): (download)

>d4goka_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]}
lrllmlgldnagkttilkkfntisptlgfniktlehrgfklniwdvgglkslrsywrnyf
estdgliwvvdsadrqrmqdcqrelqsllveerlagatllifankqdlpgalscnaiqea
leldsirshhwriqgcsavtgedllpgidwllddissr

SCOPe Domain Coordinates for d4goka_:

Click to download the PDB-style file with coordinates for d4goka_.
(The format of our PDB-style files is described here.)

Timeline for d4goka_: