SCOPe 2.08: Domain d4gnoa1: 4gno A:2-259

Lineage for d4gnoa1 (4gno A:2-259)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.109: PEP carboxykinase N-terminal domain [68922] (1 superfamily)
   contains mixed beta-sheets; topology is partly similar to that of the catalytic C-terminal domain

4. Superfamily c.109.1: PEP carboxykinase N-terminal domain [68923] (2 families)

5. Family c.109.1.1: PEP carboxykinase N-terminal domain [68924] (3 proteins)

6. Protein Cytosolic phosphoenolpyruvate carboxykinase (GTP-hydrolyzing) [69615] (2 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [225315] (42 PDB entries)

8. Domain d4gnoa1: 4gno A:2-259 [222040]
   Other proteins in same PDB: d4gnoa2
   automated match to d1khba2
   complexed with 1pe, gtp, mn, na, spv

Details for d4gnoa1

PDB Entry: 4gno, 1.5 Å

PDB Description: structure of rat cytosolic pepck ld_3g in complex with beta- sulfopyruvate and gtp

PDB Compounds: (A:) Phosphoenolpyruvate carboxykinase, cytosolic [GTP]

SCOPe Domain Sequences for d4gnoa1:

Sequence; same for both SEQRES and ATOM records:

>d4gnoa1 c.109.1.1 (A:2-259) Cytosolic phosphoenolpyruvate carboxykinase (GTP-hydrolyzing) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ppqlhngldfsakviqgsldslpqevrkfvegnaqlcqpeyihicdgseeeygrllahmq
eegvirklkkydncwlaltdprdvariesktviitqeqrdtvpipksgqsqlgrwmseed
fekafnarfpgcmkgrtmyvipfsmgplgsplakigieltdspyvvasmrimtrmgtsvl
ealgdgefikclhsvgcplplkkplvnnwacnpeltliahlpdrreiisfgsgyggnsll
gkkcfalriasrlakeeg

Timeline for d4gnoa1:

• d4gnoa1 first appeared in SCOPe 2.03
  
• d4gnoa1 appears in SCOPe 2.07