Lineage for d4gjxf_ (4gjx F:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3001353Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 3001354Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 3002276Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 3002277Protein automated matches [190159] (21 species)
    not a true protein
  7. 3002332Species Human (Homo sapiens) [TaxId:9606] [186882] (109 PDB entries)
  8. 3002565Domain d4gjxf_: 4gjx F: [221963]
    automated match to d2ox9b_
    complexed with gol; mutant

Details for d4gjxf_

PDB Entry: 4gjx (more details), 2.8 Å

PDB Description: Crystal structure of CD23 lectin domain mutant D258A
PDB Compounds: (F:) Low affinity immunoglobulin epsilon Fc receptor

SCOPe Domain Sequences for d4gjxf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gjxf_ d.169.1.0 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fvcntcpekwinfqrkcyyfgkgtkqwvharyacddmegqlvsihspeeqdfltkhasht
gswiglrnldlkgefiwvdgshvdysnwapgeptsrsqgeacvmmrgsgrwndafcdrkl
gawvcdrlatctppa

SCOPe Domain Coordinates for d4gjxf_:

Click to download the PDB-style file with coordinates for d4gjxf_.
(The format of our PDB-style files is described here.)

Timeline for d4gjxf_: