Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (9 families) |
Family d.169.1.0: automated matches [191331] (1 protein) not a true family |
Protein automated matches [190159] (16 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186882] (78 PDB entries) |
Domain d4gjxe_: 4gjx E: [221962] automated match to d2ox9b_ complexed with gol; mutant |
PDB Entry: 4gjx (more details), 2.8 Å
SCOPe Domain Sequences for d4gjxe_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4gjxe_ d.169.1.0 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]} fvcntcpekwinfqrkcyyfgkgtkqwvharyacddmegqlvsihspeeqdfltkhasht gswiglrnldlkgefiwvdgshvdysnwapgeptsrsqgeacvmmrgsgrwndafcdrkl gawvcdrlatctppa
Timeline for d4gjxe_: