Lineage for d4gjxe_ (4gjx E:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2234637Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2234638Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2235412Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 2235413Protein automated matches [190159] (16 species)
    not a true protein
  7. 2235465Species Human (Homo sapiens) [TaxId:9606] [186882] (78 PDB entries)
  8. 2235657Domain d4gjxe_: 4gjx E: [221962]
    automated match to d2ox9b_
    complexed with gol; mutant

Details for d4gjxe_

PDB Entry: 4gjx (more details), 2.8 Å

PDB Description: Crystal structure of CD23 lectin domain mutant D258A
PDB Compounds: (E:) Low affinity immunoglobulin epsilon Fc receptor

SCOPe Domain Sequences for d4gjxe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gjxe_ d.169.1.0 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fvcntcpekwinfqrkcyyfgkgtkqwvharyacddmegqlvsihspeeqdfltkhasht
gswiglrnldlkgefiwvdgshvdysnwapgeptsrsqgeacvmmrgsgrwndafcdrkl
gawvcdrlatctppa

SCOPe Domain Coordinates for d4gjxe_:

Click to download the PDB-style file with coordinates for d4gjxe_.
(The format of our PDB-style files is described here.)

Timeline for d4gjxe_: