Lineage for d4gjxc_ (4gjx C:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1940569Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 1940570Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 1941287Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 1941288Protein automated matches [190159] (13 species)
    not a true protein
  7. 1941334Species Human (Homo sapiens) [TaxId:9606] [186882] (65 PDB entries)
  8. 1941503Domain d4gjxc_: 4gjx C: [221960]
    automated match to d2ox9b_
    complexed with gol; mutant

Details for d4gjxc_

PDB Entry: 4gjx (more details), 2.8 Å

PDB Description: Crystal structure of CD23 lectin domain mutant D258A
PDB Compounds: (C:) Low affinity immunoglobulin epsilon Fc receptor

SCOPe Domain Sequences for d4gjxc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gjxc_ d.169.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fvcntcpekwinfqrkcyyfgkgtkqwvharyacddmegqlvsihspeeqdfltkhasht
gswiglrnldlkgefiwvdgshvdysnwapgeptsrsqgeacvmmrgsgrwndafcdrkl
gawvcdrlatctpp

SCOPe Domain Coordinates for d4gjxc_:

Click to download the PDB-style file with coordinates for d4gjxc_.
(The format of our PDB-style files is described here.)

Timeline for d4gjxc_: