Lineage for d4gjea_ (4gje A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1996349Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1996350Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 1996818Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
    Duplication: made with two pairs of EF-hands
  6. 1997314Protein Troponin C [47503] (6 species)
  7. 1997349Species Human (Homo sapiens), cardiac isoform [TaxId:9606] [47508] (17 PDB entries)
  8. 1997351Domain d4gjea_: 4gje A: [221955]
    automated match to d1mxlc_
    complexed with act, ca, cd

Details for d4gjea_

PDB Entry: 4gje (more details), 1.6 Å

PDB Description: crystal structure of the refolded amino-terminal domain of human cardiac troponin c in complex with cadmium
PDB Compounds: (A:) troponin c, slow skeletal and cardiac muscles

SCOPe Domain Sequences for d4gjea_:

Sequence, based on SEQRES records: (download)

>d4gjea_ a.39.1.5 (A:) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]}
mddiykaaveqlteeqknefkaafdifvlgaedgcistkelgkvmrmlgqnptpeelqem
idevdedgsgtvdfdeflvmmvrcmkdds

Sequence, based on observed residues (ATOM records): (download)

>d4gjea_ a.39.1.5 (A:) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]}
mddiykaaveqlteeqknefkaafdifvlgaedgcistkelgkvmrmlgqnptpeelqem
idevdegtvdfdeflvmmvrcmkdds

SCOPe Domain Coordinates for d4gjea_:

Click to download the PDB-style file with coordinates for d4gjea_.
(The format of our PDB-style files is described here.)

Timeline for d4gjea_: