Class a: All alpha proteins [46456] (289 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
Family a.39.1.5: Calmodulin-like [47502] (24 proteins) Duplication: made with two pairs of EF-hands |
Protein Troponin C [47503] (6 species) |
Species Human (Homo sapiens), cardiac isoform [TaxId:9606] [47508] (17 PDB entries) |
Domain d4gjea_: 4gje A: [221955] automated match to d1mxlc_ complexed with act, ca, cd |
PDB Entry: 4gje (more details), 1.6 Å
SCOPe Domain Sequences for d4gjea_:
Sequence, based on SEQRES records: (download)
>d4gjea_ a.39.1.5 (A:) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} mddiykaaveqlteeqknefkaafdifvlgaedgcistkelgkvmrmlgqnptpeelqem idevdedgsgtvdfdeflvmmvrcmkdds
>d4gjea_ a.39.1.5 (A:) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} mddiykaaveqlteeqknefkaafdifvlgaedgcistkelgkvmrmlgqnptpeelqem idevdegtvdfdeflvmmvrcmkdds
Timeline for d4gjea_: