Lineage for d4gj0d_ (4gj0 D:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1442549Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 1442550Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 1443240Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 1443241Protein automated matches [190159] (8 species)
    not a true protein
  7. 1443271Species Human (Homo sapiens) [TaxId:9606] [186882] (56 PDB entries)
  8. 1443353Domain d4gj0d_: 4gj0 D: [221936]
    automated match to d2ox9b_
    complexed with gol, so4; mutant

Details for d4gj0d_

PDB Entry: 4gj0 (more details), 1.95 Å

PDB Description: Crystal structure of CD23 lectin domain mutant S252A
PDB Compounds: (D:) Low affinity immunoglobulin epsilon Fc receptor

SCOPe Domain Sequences for d4gj0d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gj0d_ d.169.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vcntcpekwinfqrkcyyfgkgtkqwvharyacddmegqlvsihspeeqdfltkhashtg
swiglrnldlkgefiwvdgshvdysnwapgeptarsqgedcvmmrgsgrwndafcdrklg
awvcdrlatc

SCOPe Domain Coordinates for d4gj0d_:

Click to download the PDB-style file with coordinates for d4gj0d_.
(The format of our PDB-style files is described here.)

Timeline for d4gj0d_: