Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (9 families) |
Family d.169.1.0: automated matches [191331] (1 protein) not a true family |
Protein automated matches [190159] (12 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186882] (61 PDB entries) |
Domain d4gi0b_: 4gi0 B: [221921] automated match to d2ox9b_ complexed with gol; mutant |
PDB Entry: 4gi0 (more details), 2.27 Å
SCOPe Domain Sequences for d4gi0b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4gi0b_ d.169.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} cntcpekwinfqrkcyyfgkgtkqwvharyacddmegqlvsihspeeqdfltkhashtgs wiglrnldlkgefiwvdgshvdysnwapgaptsrsqgedcvmmrgsgrwndafcdrklga wvcdrlatc
Timeline for d4gi0b_: