Lineage for d1qrkb3 (1qrk B:628-727)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 788243Superfamily b.1.5: Transglutaminase, two C-terminal domains [49309] (1 family) (S)
  5. 788244Family b.1.5.1: Transglutaminase, two C-terminal domains [49310] (1 protein)
  6. 788245Protein Transglutaminase, two C-terminal domains [49311] (4 species)
    duplication
  7. 788246Species Human (Homo sapiens), blood isozyme [TaxId:9606] [49312] (8 PDB entries)
    Coagulation factor XIII,
  8. 788274Domain d1qrkb3: 1qrk B:628-727 [22190]
    Other proteins in same PDB: d1qrka1, d1qrka4, d1qrkb1, d1qrkb4
    complexed with sr

Details for d1qrkb3

PDB Entry: 1qrk (more details), 2.5 Å

PDB Description: human factor xiii with strontium bound in the ion site
PDB Compounds: (B:) protein (coagulation factor xiii)

SCOP Domain Sequences for d1qrkb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qrkb3 b.1.5.1 (B:628-727) Transglutaminase, two C-terminal domains {Human (Homo sapiens), blood isozyme [TaxId: 9606]}
tipeiiikvrgtqvvgsdmtvtveftnplketlrnvwvhldgpgvtrpmkkmfreirpns
tvqweevcrpwvsghrkliasmssdslrhvygeldvqiqr

SCOP Domain Coordinates for d1qrkb3:

Click to download the PDB-style file with coordinates for d1qrkb3.
(The format of our PDB-style files is described here.)

Timeline for d1qrkb3: