SCOPe 2.08: Domain d4gfta_: 4gft A:

Lineage for d4gfta_ (4gft A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.0: automated matches [191396] (1 protein)
   not a true family

6. Protein automated matches [190513] (36 species)
   not a true protein

7. Species Plasmodium falciparum [TaxId:36329] [226712] (3 PDB entries)

8. Domain d4gfta_: 4gft A: [221889]
   Other proteins in same PDB: d4gftb1, d4gftb2
   automated match to d2fcea1
   complexed with edo

Details for d4gfta_

PDB Entry: 4gft, 1.6 Å

PDB Description: malaria invasion machinery protein-nanobody complex

PDB Compounds: (A:) myosin a tail domain interacting protein

SCOPe Domain Sequences for d4gfta_:

Sequence, based on SEQRES records:

>d4gfta_ a.39.1.0 (A:) automated matches {Plasmodium falciparum [TaxId: 36329]}
nveelikmfahfdnnstgyltksqmknilttwgdaltdqeaidalnafssednidyklfc
edilq

Sequence, based on observed residues (ATOM records):

>d4gfta_ a.39.1.0 (A:) automated matches {Plasmodium falciparum [TaxId: 36329]}
nveelikmfahfdnnstgyltksqmknilttwaltdqeaidalnafssednidyklfced
ilq

Timeline for d4gfta_:

• d4gfta_ first appeared in SCOPe 2.03
  
• d4gfta_ appears in SCOPe 2.07