Class a: All alpha proteins [46456] (290 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
Family a.39.1.0: automated matches [191396] (1 protein) not a true family |
Protein automated matches [190513] (36 species) not a true protein |
Species Plasmodium falciparum [TaxId:36329] [226712] (3 PDB entries) |
Domain d4gfta_: 4gft A: [221889] Other proteins in same PDB: d4gftb1, d4gftb2 automated match to d2fcea1 complexed with edo |
PDB Entry: 4gft (more details), 1.6 Å
SCOPe Domain Sequences for d4gfta_:
Sequence, based on SEQRES records: (download)
>d4gfta_ a.39.1.0 (A:) automated matches {Plasmodium falciparum [TaxId: 36329]} nveelikmfahfdnnstgyltksqmknilttwgdaltdqeaidalnafssednidyklfc edilq
>d4gfta_ a.39.1.0 (A:) automated matches {Plasmodium falciparum [TaxId: 36329]} nveelikmfahfdnnstgyltksqmknilttwaltdqeaidalnafssednidyklfced ilq
Timeline for d4gfta_: