Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily) 8-stranded mixed beta-sheet; 2 layers: alpha/beta |
Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) |
Family d.122.1.0: automated matches [227160] (1 protein) not a true family |
Protein automated matches [226867] (22 species) not a true protein |
Species Enterococcus faecalis [TaxId:226185] [226590] (9 PDB entries) |
Domain d4geea1: 4gee A:18-224 [221875] Other proteins in same PDB: d4geea2 automated match to d1kzna_ protein/DNA complex; complexed with 0wt, gol |
PDB Entry: 4gee (more details), 1.7 Å
SCOPe Domain Sequences for d4geea1:
Sequence, based on SEQRES records: (download)
>d4geea1 d.122.1.0 (A:18-224) automated matches {Enterococcus faecalis [TaxId: 226185]} gleavrkrpgmyigstsgeglhhlvweivdnsidealagfaksiqviiepddsitviddg rgipvgiqaktgrpavetvftvlhaggkfggggykvsgglhgvgssvvnalstsldvrvy kdgkvyyqeyrrgavvddlkvieetdrhgttvhfipdpeiftettvydfdklatrvrela flnrglhisiedrregqedkkeyhyeg
>d4geea1 d.122.1.0 (A:18-224) automated matches {Enterococcus faecalis [TaxId: 226185]} gleavrkrpgmyigstsgeglhhlvweivdnsidealagfaksiqviiepddsitviddg rgipvgiqaktgrpavetvftvlhgvgssvvnalstsldvrvykdgkvyyqeyrrgavvd dlkvieetdrhgttvhfipdpeiftettvydfdklatrvrelaflnrglhisiedrregq edkkeyhyeg
Timeline for d4geea1: