Lineage for d4gdka_ (4gdk A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1402144Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1402145Superfamily d.15.1: Ubiquitin-like [54236] (9 families) (S)
  5. 1403010Family d.15.1.0: automated matches [191343] (1 protein)
    not a true family
  6. 1403011Protein automated matches [190233] (6 species)
    not a true protein
  7. 1403019Species Human (Homo sapiens) [TaxId:9606] [187090] (15 PDB entries)
  8. 1403037Domain d4gdka_: 4gdk A: [221855]
    automated match to d4gdla_
    complexed with na

Details for d4gdka_

PDB Entry: 4gdk (more details), 2.7 Å

PDB Description: crystal structure of human atg12~atg5 conjugate in complex with an n- terminal fragment of atg16l1
PDB Compounds: (A:) Ubiquitin-like protein ATG12

SCOPe Domain Sequences for d4gdka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gdka_ d.15.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kkidillkavgdtpimktkkwavertrtiqglidfikkflklvaseqlfiyvnqsfapsp
dqevgtlyecfgsdgklvlhycksqawg

SCOPe Domain Coordinates for d4gdka_:

Click to download the PDB-style file with coordinates for d4gdka_.
(The format of our PDB-style files is described here.)

Timeline for d4gdka_: