Lineage for d1ggya3 (1ggy A:628-727)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 455505Superfamily b.1.5: Transglutaminase, two C-terminal domains [49309] (1 family) (S)
  5. 455506Family b.1.5.1: Transglutaminase, two C-terminal domains [49310] (1 protein)
  6. 455507Protein Transglutaminase, two C-terminal domains [49311] (4 species)
    duplication
  7. 455508Species Human (Homo sapiens), blood isozyme [TaxId:9606] [49312] (8 PDB entries)
    Coagulation factor XIII,
  8. 455534Domain d1ggya3: 1ggy A:628-727 [22184]
    Other proteins in same PDB: d1ggya1, d1ggya4, d1ggyb1, d1ggyb4

Details for d1ggya3

PDB Entry: 1ggy (more details), 2.5 Å

PDB Description: human factor xiii with ytterbium bound in the ion site

SCOP Domain Sequences for d1ggya3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ggya3 b.1.5.1 (A:628-727) Transglutaminase, two C-terminal domains {Human (Homo sapiens), blood isozyme}
tipeiiikvrgtqvvgsdmtvtveftnplketlrnvwvhldgpgvtrpmkkmfreirpns
tvqweevcrpwvsghrkliasmssdslrhvygeldvqiqr

SCOP Domain Coordinates for d1ggya3:

Click to download the PDB-style file with coordinates for d1ggya3.
(The format of our PDB-style files is described here.)

Timeline for d1ggya3: