Class b: All beta proteins [48724] (144 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.5: Transglutaminase, two C-terminal domains [49309] (1 family) |
Family b.1.5.1: Transglutaminase, two C-terminal domains [49310] (1 protein) |
Protein Transglutaminase, two C-terminal domains [49311] (4 species) duplication |
Species Human (Homo sapiens), blood isozyme [TaxId:9606] [49312] (8 PDB entries) Coagulation factor XIII, |
Domain d1ggya2: 1ggy A:516-627 [22183] Other proteins in same PDB: d1ggya1, d1ggya4, d1ggyb1, d1ggyb4 |
PDB Entry: 1ggy (more details), 2.5 Å
SCOP Domain Sequences for d1ggya2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ggya2 b.1.5.1 (A:516-627) Transglutaminase, two C-terminal domains {Human (Homo sapiens), blood isozyme} snvdmdfevenavlgkdfklsitfrnnshnrytitaylsanitfytgvpkaefkketfdv tleplsfkkeavliqageymgqlleqaslhffvtarinetrdvlakqkstvl
Timeline for d1ggya2:
View in 3D Domains from other chains: (mouse over for more information) d1ggyb1, d1ggyb2, d1ggyb3, d1ggyb4 |