SCOPe 2.05: Domain d4gayb2: 4gay B:108-212

Lineage for d4gayb2 (4gay B:108-212)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (14 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (368 PDB entries)

8. Domain d4gayb2: 4gay B:108-212 [221826]
   Other proteins in same PDB: d4gayb1, d4gayl1
   automated match to d1tqbc2
   complexed with pge

Details for d4gayb2

PDB Entry: 4gay, 2.65 Å

PDB Description: Structure of the broadly neutralizing antibody AP33

PDB Compounds: (B:) neutralizing antibody ap33 light chain

SCOPe Domain Sequences for d4gayb2:

Sequence; same for both SEQRES and ATOM records:

>d4gayb2 b.1.1.2 (B:108-212) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrn

Timeline for d4gayb2:

• d4gayb2 first appeared in SCOPe 2.03
  
• d4gayb2 appears in SCOPe 2.04
  
• d4gayb2 appears in SCOPe 2.06
  
• d4gayb2 appears in the current release, SCOPe 2.08