Lineage for d4gaxa2 (4gax A:219-546)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1281954Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 1281955Superfamily a.128.1: Terpenoid synthases [48576] (6 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 1282215Family a.128.1.0: automated matches [196408] (1 protein)
    not a true family
  6. 1282216Protein automated matches [196409] (21 species)
    not a true protein
  7. 1282217Species Artemisia annua [TaxId:35608] [226617] (2 PDB entries)
  8. 1282219Domain d4gaxa2: 4gax A:219-546 [221824]
    Other proteins in same PDB: d4gaxa1
    automated match to d1hxga2
    mutant

Details for d4gaxa2

PDB Entry: 4gax (more details), 1.99 Å

PDB Description: crystal structure of an alpha-bisabolol synthase mutant
PDB Compounds: (A:) Amorpha-4,11-diene synthase

SCOPe Domain Sequences for d4gaxa2:

Sequence, based on SEQRES records: (download)

>d4gaxa2 a.128.1.0 (A:219-546) automated matches {Artemisia annua [TaxId: 35608]}
hnktliklaklefnllqslhreelsqlskwwkafdvknnapysrdrivecyfwalasrfe
pqysrariflakvialvtliddiydaygtyeelkifteaierwsitcldmipeymkpiyk
lfmdtytemeeilakegktnifncgkefvkdfvrnlmveaqwaneghiptteeldsvavi
tgganlltttcylgmsdivtkeafewavseppllrykgilgrrlndlaghkeeqerkhvs
ssvesymkeynvseeyaknllykqvedlwkdinreylitktiprpllvavinlvhfldvl
yaakdaftamgeeyknlvksllvypmsi

Sequence, based on observed residues (ATOM records): (download)

>d4gaxa2 a.128.1.0 (A:219-546) automated matches {Artemisia annua [TaxId: 35608]}
hnktliklaklefnllqslhreelsqlskwwkafdvknnapysrdrivecyfwalasrfe
pqysrariflakvialvtliddiydaygtyeelkifteaierwsitcldmipeymkpiyk
lfmdtytemeeilakegktnifncgkefvkdfvrnlmveaqwaneghiptteeldsvavi
tgganlltttcylgmsdivtkeafewavseppllrykgilgrrlndlaghsssvesymke
ynvseeyaknllykqvedlwkdinreylitktiprpllvavinlvhfldvlyaakdafta
mgeeyknlvksllvypmsi

SCOPe Domain Coordinates for d4gaxa2:

Click to download the PDB-style file with coordinates for d4gaxa2.
(The format of our PDB-style files is described here.)

Timeline for d4gaxa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4gaxa1