Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
Family c.1.11.2: D-glucarate dehydratase-like [51609] (15 proteins) |
Protein automated matches [226997] (11 species) not a true protein |
Species Actinobacillus succinogenes [TaxId:339671] [226437] (1 PDB entry) |
Domain d4g8tc2: 4g8t C:134-442 [221794] Other proteins in same PDB: d4g8ta1, d4g8tb1, d4g8tc1, d4g8td1 automated match to d1ec7a1 complexed with dtt, dtu, gol, na, so4 |
PDB Entry: 4g8t (more details), 1.7 Å
SCOPe Domain Sequences for d4g8tc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4g8tc2 c.1.11.2 (C:134-442) automated matches {Actinobacillus succinogenes [TaxId: 339671]} dgqqrdavemlgylffigdrkkttlayqnqendpcdwyrvrheeamtpesvvrlaeaaye kygfndfklkggvldgfeeaeavtalakrfpdaritldpngawsldeavkigkqlkgvla yaedpcgaeqgysgreimaefrratglptatnmiatdwrqmghtislqsvdipladphfw tmqgsirvaqmchewgltwgshsnnhfdislamfthvaaaapgditaidthwiwqegnqr ltkepfqikgglvevpkkpglgveldmdqvmkanelyksmglgarddamamqflipgwkf dnkkpclvr
Timeline for d4g8tc2: