SCOPe 2.06: Domain d4g8tb1: 4g8t B:2-133

Lineage for d4g8tb1 (4g8t B:2-133)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (88 species)
   not a true protein

7. Species Actinobacillus succinogenes [TaxId:339671] [225929] (4 PDB entries)

8. Domain d4g8tb1: 4g8t B:2-133 [221791]
   Other proteins in same PDB: d4g8ta2, d4g8tb2, d4g8tc2, d4g8td2
   automated match to d1ec7a2
   complexed with dtt, dtu, gol, na, so4

Details for d4g8tb1

PDB Entry: 4g8t, 1.7 Å

PDB Description: Crystal structure of a glucarate dehydratase related protein, from actinobacillus succinogenes, target EFI-502312, with sodium and sulfate bound, ordered loop

PDB Compounds: (B:) glucarate dehydratase

SCOPe Domain Sequences for d4g8tb1:

Sequence; same for both SEQRES and ATOM records:

>d4g8tb1 d.54.1.0 (B:2-133) automated matches {Actinobacillus succinogenes [TaxId: 339671]}
stpiitemqvipvaghdsmllnlsgahspyftrnivilkdnsgntgvgevpggekirqtl
edakplvigktlgeyknvmntvrqtfndhdaggrglqtfdlrttihvvtaieaamldllg
qflgvtvasllg

Timeline for d4g8tb1:

• d4g8tb1 first appeared in SCOPe 2.03
  
• d4g8tb1 appears in SCOPe 2.05
  
• d4g8tb1 appears in SCOPe 2.07
  
• d4g8tb1 appears in the current release, SCOPe 2.08