SCOPe 2.05: Domain d4g8fb2: 4g8f B:128-256

Lineage for d4g8fb2 (4g8f B:128-256)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (14 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (409 PDB entries)

8. Domain d4g8fb2: 4g8f B:128-256 [221775]
   Other proteins in same PDB: d4g8fa1, d4g8fb1
   automated match to d1ktke2

Details for d4g8fb2

PDB Entry: 4g8f, 2.1 Å

PDB Description: crystal structure of clone42 tcr

PDB Compounds: (B:) beta chain clone 42 TCR

SCOPe Domain Sequences for d4g8fb2:

Sequence; same for both SEQRES and ATOM records:

>d4g8fb2 b.1.1.2 (B:128-256) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgrad

Timeline for d4g8fb2:

• d4g8fb2 first appeared in SCOPe 2.03
  
• d4g8fb2 appears in SCOPe 2.04
  
• d4g8fb2 appears in SCOPe 2.06
  
• d4g8fb2 appears in the current release, SCOPe 2.08