Class b: All beta proteins [48724] (176 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) contains copper-binding site |
Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (3 proteins) |
Protein Cytochrome c oxidase [49544] (4 species) |
Species Thermus thermophilus, ba3 type [TaxId:274] [49547] (30 PDB entries) |
Domain d4g7sb2: 4g7s B:41-168 [221754] Other proteins in same PDB: d4g7sa_, d4g7sb1, d4g7sc_ automated match to d1ehkb1 complexed with cu, cua, has, hem, olc, per; mutant |
PDB Entry: 4g7s (more details), 2 Å
SCOPe Domain Sequences for d4g7sb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4g7sb2 b.6.1.2 (B:41-168) Cytochrome c oxidase {Thermus thermophilus, ba3 type [TaxId: 274]} tagvipagklervdpttvrqegpwadpaqavvqtgpnqytvyvlafafgyqpnpievpqg aeivfkitspdvihgfhvegtninvevlpgevstvrytfkrpgeyriicnqycglghqnm fgtivvke
Timeline for d4g7sb2: