Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
Fold f.17: Transmembrane helix hairpin [81334] (5 superfamilies) two antiparallel transmembrane helices |
Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (2 families) |
Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (5 proteins) |
Protein Bacterial ba3 type cytochrome c oxidase subunit II [81460] (1 species) |
Species Thermus thermophilus [TaxId:274] [81459] (19 PDB entries) the "missing" first helix is complemented by the ba3 subunit IIa |
Domain d4g7sb1: 4g7s B:3-40 [221753] Other proteins in same PDB: d4g7sa_, d4g7sb2, d4g7sc_ automated match to d1ehkb2 complexed with cua, cub, has, hem, olc, per; mutant |
PDB Entry: 4g7s (more details), 2 Å
SCOPe Domain Sequences for d4g7sb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4g7sb1 f.17.2.1 (B:3-40) Bacterial ba3 type cytochrome c oxidase subunit II {Thermus thermophilus [TaxId: 274]} dehkahkailayekgwlafslamlfvfialiaytlath
Timeline for d4g7sb1: