Lineage for d4g71b1 (4g71 B:3-40)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2577253Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies)
    two antiparallel transmembrane helices
  4. 2577295Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (2 families) (S)
  5. 2577296Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (5 proteins)
  6. 2577316Protein Bacterial ba3 type cytochrome c oxidase subunit II [81460] (1 species)
  7. 2577317Species Thermus thermophilus [TaxId:274] [81459] (23 PDB entries)
    the "missing" first helix is complemented by the ba3 subunit IIa
  8. 2577331Domain d4g71b1: 4g71 B:3-40 [221738]
    Other proteins in same PDB: d4g71a_, d4g71b2, d4g71c_
    automated match to d1ehkb2
    complexed with cua, cub, has, hem, olc, per; mutant

Details for d4g71b1

PDB Entry: 4g71 (more details), 2.9 Å

PDB Description: Structure of Recombinant Cytochrome ba3 Oxidase mutant V236N from Thermus thermophilus
PDB Compounds: (B:) Cytochrome c oxidase subunit 2

SCOPe Domain Sequences for d4g71b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4g71b1 f.17.2.1 (B:3-40) Bacterial ba3 type cytochrome c oxidase subunit II {Thermus thermophilus [TaxId: 274]}
dehkahkailayekgwlafslamlfvfialiaytlath

SCOPe Domain Coordinates for d4g71b1:

Click to download the PDB-style file with coordinates for d4g71b1.
(The format of our PDB-style files is described here.)

Timeline for d4g71b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4g71b2