Lineage for d4g6za2 (4g6z A:305-466)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1276187Fold a.97: An anticodon-binding domain of class I aminoacyl-tRNA synthetases [48162] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 1276188Superfamily a.97.1: An anticodon-binding domain of class I aminoacyl-tRNA synthetases [48163] (3 families) (S)
  5. 1276215Family a.97.1.0: automated matches [227179] (1 protein)
    not a true family
  6. 1276216Protein automated matches [226898] (4 species)
    not a true protein
  7. 1276220Species Burkholderia thailandensis [TaxId:271848] [226428] (1 PDB entry)
  8. 1276221Domain d4g6za2: 4g6z A:305-466 [221734]
    Other proteins in same PDB: d4g6za1
    automated match to d1j09a1
    complexed with cl, glu, mpd, na

Details for d4g6za2

PDB Entry: 4g6z (more details), 2.05 Å

PDB Description: crystal structure of a glutamyl-trna synthetase glurs from burkholderia thailandensis bound to l-glutamate
PDB Compounds: (A:) Glutamate-tRNA ligase

SCOPe Domain Sequences for d4g6za2:

Sequence, based on SEQRES records: (download)

>d4g6za2 a.97.1.0 (A:305-466) automated matches {Burkholderia thailandensis [TaxId: 271848]}
dhnklnwlnnhyikeaddarlaglakpffaalgidagaieqgpdlvsvmglmkdrastvk
eiaensamfyrapapgadalaqhvtdavrpalvefaaalktvewtkeaiaaalkavlgah
klkmpqlampvrllvagtthtpsidavlllfgrdvvvsriea

Sequence, based on observed residues (ATOM records): (download)

>d4g6za2 a.97.1.0 (A:305-466) automated matches {Burkholderia thailandensis [TaxId: 271848]}
dhnklnwlnnhyikeaddarlaglakpffaalgidagaieqgpdlvsvmglmkdrastvk
eiaensamfyrapahtpsidavlllfgrdvvvsriea

SCOPe Domain Coordinates for d4g6za2:

Click to download the PDB-style file with coordinates for d4g6za2.
(The format of our PDB-style files is described here.)

Timeline for d4g6za2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4g6za1