Class b: All beta proteins [48724] (176 folds) |
Fold b.69: 7-bladed beta-propeller [50964] (14 superfamilies) consists of seven 4-stranded beta-sheet motifs; meander |
Superfamily b.69.6: Clathrin heavy-chain terminal domain [50989] (1 family) |
Family b.69.6.1: Clathrin heavy-chain terminal domain [50990] (2 proteins) |
Protein automated matches [227067] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [226191] (2 PDB entries) |
Domain d4g55a1: 4g55 A:0-330 [221728] Other proteins in same PDB: d4g55a2 automated match to d1bpoa2 complexed with act, dms, edo, peg, vh2 |
PDB Entry: 4g55 (more details), 1.69 Å
SCOPe Domain Sequences for d4g55a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4g55a1 b.69.6.1 (A:0-330) automated matches {Human (Homo sapiens) [TaxId: 9606]} fmaqilpirfqehlqlqnlginpanigfstltmesdkficirekvgeqaqvviidmndps npirrpisadsaimnpaskvialkagktlqifniemkskmkahtmtddvtfwkwislntv alvtdnavyhwsmegesqpvkmfdrhsslagcqiinyrtdakqkwllltgisaqqnrvvg amqlysvdrkvsqpieghaasfaqfkmegnaeestlfcfavrgqaggklhiievgtpptg nqpfpkkavdvffppeaqndfpvamqisekhdvvflitkygyihlydletgtciymnris getifvtapheatagiigvnrkgqvlsvcve
Timeline for d4g55a1: