Lineage for d4g55a1 (4g55 A:1-330)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2808719Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2809391Superfamily b.69.6: Clathrin heavy-chain terminal domain [50989] (1 family) (S)
  5. 2809392Family b.69.6.1: Clathrin heavy-chain terminal domain [50990] (2 proteins)
  6. 2809405Protein automated matches [227067] (1 species)
    not a true protein
  7. 2809406Species Human (Homo sapiens) [TaxId:9606] [226191] (6 PDB entries)
  8. 2809409Domain d4g55a1: 4g55 A:1-330 [221728]
    Other proteins in same PDB: d4g55a2, d4g55a3
    automated match to d1bpoa2
    complexed with act, dms, edo, peg, vh2

Details for d4g55a1

PDB Entry: 4g55 (more details), 1.69 Å

PDB Description: Clathrin terminal domain complexed with pitstop 2
PDB Compounds: (A:) Clathrin heavy chain 1

SCOPe Domain Sequences for d4g55a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4g55a1 b.69.6.1 (A:1-330) automated matches {Human (Homo sapiens) [TaxId: 9606]}
maqilpirfqehlqlqnlginpanigfstltmesdkficirekvgeqaqvviidmndpsn
pirrpisadsaimnpaskvialkagktlqifniemkskmkahtmtddvtfwkwislntva
lvtdnavyhwsmegesqpvkmfdrhsslagcqiinyrtdakqkwllltgisaqqnrvvga
mqlysvdrkvsqpieghaasfaqfkmegnaeestlfcfavrgqaggklhiievgtpptgn
qpfpkkavdvffppeaqndfpvamqisekhdvvflitkygyihlydletgtciymnrisg
etifvtapheatagiigvnrkgqvlsvcve

SCOPe Domain Coordinates for d4g55a1:

Click to download the PDB-style file with coordinates for d4g55a1.
(The format of our PDB-style files is described here.)

Timeline for d4g55a1: