Lineage for d4g51d_ (4g51 D:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2687001Protein Hemoglobin, beta-chain [46500] (26 species)
  7. 2687079Species Emerald rockcod (Pagothenia bernacchii) [TaxId:40690] [46511] (12 PDB entries)
  8. 2687098Domain d4g51d_: 4g51 D: [221727]
    Other proteins in same PDB: d4g51a_, d4g51c_
    automated match to d1pbxb_
    complexed with hem, no

Details for d4g51d_

PDB Entry: 4g51 (more details), 2.5 Å

PDB Description: crystallographic analysis of the interaction of nitric oxide with hemoglobin from trematomus bernacchii in the t quaternary structure (fully ligated state).
PDB Compounds: (D:) Hemoglobin subunit beta

SCOPe Domain Sequences for d4g51d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4g51d_ a.1.1.2 (D:) Hemoglobin, beta-chain {Emerald rockcod (Pagothenia bernacchii) [TaxId: 40690]}
vewtdkersiisdifshmdyddigpkalsrclivypwtqrhfsgfgnlynaeaiignanv
aahgikvlhgldrgvknmdniaatyadlstlhseklhvdpdnfkllsdcitivlaakmgh
aftaetqgafqkflavvvsalgkqyh

SCOPe Domain Coordinates for d4g51d_:

Click to download the PDB-style file with coordinates for d4g51d_.
(The format of our PDB-style files is described here.)

Timeline for d4g51d_: