Class a: All alpha proteins [46456] (289 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
Protein Hemoglobin, alpha-chain [46486] (24 species) |
Species Emerald rockcod (Pagothenia bernacchii) [TaxId:40690] [46495] (12 PDB entries) |
Domain d4g51a_: 4g51 A: [221724] Other proteins in same PDB: d4g51b_, d4g51d_ automated match to d1s5xa_ complexed with hem, no |
PDB Entry: 4g51 (more details), 2.5 Å
SCOPe Domain Sequences for d4g51a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4g51a_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Emerald rockcod (Pagothenia bernacchii) [TaxId: 40690]} slsdkdkaavralwskigksadaigndalsrmivvypqtktyfshwpdvtpgsphikahg kkvmggialavskiddlktglmelseqhayklrvdpanfkilnhcilvvistmfpkeftp eahvsldkflsgvalalaeryr
Timeline for d4g51a_: