Lineage for d4g51a_ (4g51 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1976410Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1976411Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1976495Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1976766Protein Hemoglobin, alpha-chain [46486] (24 species)
  7. 1976841Species Emerald rockcod (Pagothenia bernacchii) [TaxId:40690] [46495] (12 PDB entries)
  8. 1976857Domain d4g51a_: 4g51 A: [221724]
    Other proteins in same PDB: d4g51b_, d4g51d_
    automated match to d1s5xa_
    complexed with hem, no

Details for d4g51a_

PDB Entry: 4g51 (more details), 2.5 Å

PDB Description: crystallographic analysis of the interaction of nitric oxide with hemoglobin from trematomus bernacchii in the t quaternary structure (fully ligated state).
PDB Compounds: (A:) Hemoglobin subunit alpha

SCOPe Domain Sequences for d4g51a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4g51a_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Emerald rockcod (Pagothenia bernacchii) [TaxId: 40690]}
slsdkdkaavralwskigksadaigndalsrmivvypqtktyfshwpdvtpgsphikahg
kkvmggialavskiddlktglmelseqhayklrvdpanfkilnhcilvvistmfpkeftp
eahvsldkflsgvalalaeryr

SCOPe Domain Coordinates for d4g51a_:

Click to download the PDB-style file with coordinates for d4g51a_.
(The format of our PDB-style files is described here.)

Timeline for d4g51a_: