SCOP 1.75: Domain d1ggta3: 1ggt A:628-729

Lineage for d1ggta3 (1ggt A:628-729)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.5: Transglutaminase, two C-terminal domains [49309] (1 family)

5. Family b.1.5.1: Transglutaminase, two C-terminal domains [49310] (1 protein)

6. Protein Transglutaminase, two C-terminal domains [49311] (4 species)
   duplication

7. Species Human (Homo sapiens), blood isozyme [TaxId:9606] [49312] (8 PDB entries)
   Coagulation factor XIII,

8. Domain d1ggta3: 1ggt A:628-729 [22172]
   Other proteins in same PDB: d1ggta1, d1ggta4, d1ggtb1, d1ggtb4

Details for d1ggta3

PDB Entry: 1ggt, 2.65 Å

PDB Description: three-dimensional structure of a transglutaminase: human blood coagulation factor xiii

PDB Compounds: (A:) coagulation factor xiii

SCOP Domain Sequences for d1ggta3:

Sequence; same for both SEQRES and ATOM records:

>d1ggta3 b.1.5.1 (A:628-729) Transglutaminase, two C-terminal domains {Human (Homo sapiens), blood isozyme [TaxId: 9606]}
tipeiiikvrgtqvvgsdmtvtveftnplketlrnvwvhldgpgvtrpmkkmfreirpns
tvqweevcrpwvsghrkliasmssdslrhvygeldvqiqrrp

Timeline for d1ggta3:

• d1ggta3 first appeared (with stable ids) in SCOP 1.55
  
• d1ggta3 appears in SCOP 1.73
  
• d1ggta3 appears in SCOPe 2.01
  
• d1ggta3 appears in the current release, SCOPe 2.08