SCOP 1.63: Domain d1fieb3: 1fie B:628-727

Lineage for d1fieb3 (1fie B:628-727)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.5: Transglutaminase, two C-terminal domains [49309] (1 family)

5. Family b.1.5.1: Transglutaminase, two C-terminal domains [49310] (1 protein)

6. Protein Transglutaminase, two C-terminal domains [49311] (4 species)
   duplication

7. Species Human (Homo sapiens), blood isozyme [TaxId:9606] [49312] (7 PDB entries)
   Coagulation factor XIII,

8. Domain d1fieb3: 1fie B:628-727 [22170]
   Other proteins in same PDB: d1fiea1, d1fiea4, d1fieb1, d1fieb4

Details for d1fieb3

PDB Entry: 1fie, 2.5 Å

PDB Description: recombinant human coagulation factor xiii

SCOP Domain Sequences for d1fieb3:

Sequence; same for both SEQRES and ATOM records:

>d1fieb3 b.1.5.1 (B:628-727) Transglutaminase, two C-terminal domains {Human (Homo sapiens), blood isozyme}
tipeiiikvrgtqvvgsdmtvtiqftnplketlrnvwvhldgpgvtrpmkkmfreirpns
tvqweevcrpwvsghrkliasmssdslrhvygeldvqiqr

Timeline for d1fieb3:

• d1fieb3 first appeared (with stable ids) in SCOP 1.55
  
• d1fieb3 appears in SCOP 1.61
  
• d1fieb3 appears in SCOP 1.65
  
• d1fieb3 appears in the current release, SCOPe 2.08