SCOP 1.61: Domain d1fiea2: 1fie A:516-627

Lineage for d1fiea2 (1fie A:516-627)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.5: Transglutaminase, two C-terminal domains [49309] (1 family)

5. Family b.1.5.1: Transglutaminase, two C-terminal domains [49310] (1 protein)

6. Protein Transglutaminase, two C-terminal domains [49311] (4 species)

7. Species Human (Homo sapiens), blood isozyme [TaxId:9606] [49312] (7 PDB entries)

8. Domain d1fiea2: 1fie A:516-627 [22167]
   Other proteins in same PDB: d1fiea1, d1fiea4, d1fieb1, d1fieb4

Details for d1fiea2

PDB Entry: 1fie, 2.5 Å

PDB Description: recombinant human coagulation factor xiii

SCOP Domain Sequences for d1fiea2:

Sequence; same for both SEQRES and ATOM records:

>d1fiea2 b.1.5.1 (A:516-627) Transglutaminase, two C-terminal domains {Human (Homo sapiens), blood isozyme}
snvdmdfevenavlgkdfklsitfrnnshnrytitaylsanitfytgvpkaefkketfdv
tleplsfkkeavliqageymgqlleqaslhffvtarinetrdvlakqkstvl

Timeline for d1fiea2:

• d1fiea2 first appeared (with stable ids) in SCOP 1.55
  
• d1fiea2 appears in SCOP 1.59
  
• d1fiea2 appears in SCOP 1.63
  
• d1fiea2 appears in the current release, SCOPe 2.08