Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) consists of one domain of this fold |
Family c.55.3.0: automated matches [191357] (1 protein) not a true family |
Protein automated matches [190396] (35 species) not a true protein |
Species Human immunodeficiency virus type 1 [TaxId:11678] [225971] (19 PDB entries) |
Domain d4g1qa2: 4g1q A:430-554 [221663] Other proteins in same PDB: d4g1qa1, d4g1qa3, d4g1qb_ automated match to d1bqna1 protein/DNA complex; protein/RNA complex; complexed with edo, mg, so4, t27 |
PDB Entry: 4g1q (more details), 1.51 Å
SCOPe Domain Sequences for d4g1qa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4g1qa2 c.55.3.0 (A:430-554) automated matches {Human immunodeficiency virus type 1 [TaxId: 11678]} ekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelqaiylalqds glevnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahkgiggneqvd klvsa
Timeline for d4g1qa2: