Lineage for d1f13b2 (1f13 B:516-627)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 55006Superfamily b.1.5: Transglutaminase, two C-terminal domains [49309] (1 family) (S)
  5. 55007Family b.1.5.1: Transglutaminase, two C-terminal domains [49310] (1 protein)
  6. 55008Protein Transglutaminase, two C-terminal domains [49311] (2 species)
  7. 55009Species Human (Homo sapiens) [TaxId:9606] [49312] (7 PDB entries)
  8. 55012Domain d1f13b2: 1f13 B:516-627 [22165]
    Other proteins in same PDB: d1f13a1, d1f13a4, d1f13b1, d1f13b4

Details for d1f13b2

PDB Entry: 1f13 (more details), 2.1 Å

PDB Description: recombinant human cellular coagulation factor xiii

SCOP Domain Sequences for d1f13b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f13b2 b.1.5.1 (B:516-627) Transglutaminase, two C-terminal domains {Human (Homo sapiens)}
snvdmdfevenavlgkdfklsitfrnnshnrytitaylsanitfytgvpkaefkketfdv
tleplsfkkeavliqageymgqlleqaslhffvtarinetrdvlakqkstvl

SCOP Domain Coordinates for d1f13b2:

Click to download the PDB-style file with coordinates for d1f13b2.
(The format of our PDB-style files is described here.)

Timeline for d1f13b2: