Lineage for d4fz8l1 (4fz8 L:1-107)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1519111Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1519112Protein automated matches [190740] (19 species)
    not a true protein
  7. 1519212Species Human (Homo sapiens) [TaxId:9606] [187920] (522 PDB entries)
  8. 1520362Domain d4fz8l1: 4fz8 L:1-107 [221631]
    Other proteins in same PDB: d4fz8l2
    automated match to d1rhha1
    complexed with nag, zn

Details for d4fz8l1

PDB Entry: 4fz8 (more details), 2.66 Å

PDB Description: Crystal structure of C11 Fab, an ADCC mediating anti-HIV-1 antibody.
PDB Compounds: (L:) FAB light chain of human ANTI-HIV-1 ENV ANTIBODY C11

SCOPe Domain Sequences for d4fz8l1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fz8l1 b.1.1.0 (L:1-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
divmtqsplslpvtpgepasiscrssqsllhsngynyldwylqkpgqspqlliylgsnra
sgvpdrfigsgsgtdftlkisrveaedvgvfycmqalqavgfgpgtkveik

SCOPe Domain Coordinates for d4fz8l1:

Click to download the PDB-style file with coordinates for d4fz8l1.
(The format of our PDB-style files is described here.)

Timeline for d4fz8l1: