Lineage for d4fxvd1 (4fxv D:20-96)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2951860Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) (S)
  5. 2952471Family d.58.7.0: automated matches [191529] (1 protein)
    not a true family
  6. 2952472Protein automated matches [190896] (11 species)
    not a true protein
  7. 2952511Species Human (Homo sapiens) [TaxId:9606] [188315] (106 PDB entries)
  8. 2952557Domain d4fxvd1: 4fxv D:20-96 [221595]
    Other proteins in same PDB: d4fxva2, d4fxvb2, d4fxvc2, d4fxvd2
    automated match to d2cpja1

Details for d4fxvd1

PDB Entry: 4fxv (more details), 1.9 Å

PDB Description: crystal structure of an elav-like protein 1 (elavl1) from homo sapiens at 1.90 a resolution
PDB Compounds: (D:) ELAV-like protein 1

SCOPe Domain Sequences for d4fxvd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fxvd1 d.58.7.0 (D:20-96) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tnlivnylpqnmtqdelrslfssigevesaklirdkvaghslgygfvnyvtakdaerain
tlnglrlqsktikvsya

SCOPe Domain Coordinates for d4fxvd1:

Click to download the PDB-style file with coordinates for d4fxvd1.
(The format of our PDB-style files is described here.)

Timeline for d4fxvd1: