![]() | Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) ![]() |
![]() | Family d.58.7.0: automated matches [191529] (1 protein) not a true family |
![]() | Protein automated matches [190896] (7 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [188315] (59 PDB entries) |
![]() | Domain d4fxvc_: 4fxv C: [221594] automated match to d2cpja1 |
PDB Entry: 4fxv (more details), 1.9 Å
SCOPe Domain Sequences for d4fxvc_:
Sequence, based on SEQRES records: (download)
>d4fxvc_ d.58.7.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} yfqgtnlivnylpqnmtqdelrslfssigevesaklirdkvaghslgygfvnyvtakdae raintlnglrlqsktikvsyarps
>d4fxvc_ d.58.7.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} yfqgtnlivnylpqnmtqdelrslfssigevesaklirdkghslgygfvnyvtakdaera intlnglrlqsktikvsyarps
Timeline for d4fxvc_: