Lineage for d4fxvc_ (4fxv C:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1413688Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1415602Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 1416109Family d.58.7.0: automated matches [191529] (1 protein)
    not a true family
  6. 1416110Protein automated matches [190896] (3 species)
    not a true protein
  7. 1416117Species Human (Homo sapiens) [TaxId:9606] [188315] (18 PDB entries)
  8. 1416133Domain d4fxvc_: 4fxv C: [221594]
    automated match to d2cpja1

Details for d4fxvc_

PDB Entry: 4fxv (more details), 1.9 Å

PDB Description: crystal structure of an elav-like protein 1 (elavl1) from homo sapiens at 1.90 a resolution
PDB Compounds: (C:) ELAV-like protein 1

SCOPe Domain Sequences for d4fxvc_:

Sequence, based on SEQRES records: (download)

>d4fxvc_ d.58.7.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
yfqgtnlivnylpqnmtqdelrslfssigevesaklirdkvaghslgygfvnyvtakdae
raintlnglrlqsktikvsyarps

Sequence, based on observed residues (ATOM records): (download)

>d4fxvc_ d.58.7.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
yfqgtnlivnylpqnmtqdelrslfssigevesaklirdkghslgygfvnyvtakdaera
intlnglrlqsktikvsyarps

SCOPe Domain Coordinates for d4fxvc_:

Click to download the PDB-style file with coordinates for d4fxvc_.
(The format of our PDB-style files is described here.)

Timeline for d4fxvc_: