SCOPe 2.03: Domain d4fxva_: 4fxv A:

Lineage for d4fxva_ (4fxv A:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families)

5. Family d.58.7.0: automated matches [191529] (1 protein)
   not a true family

6. Protein automated matches [190896] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188315] (18 PDB entries)

8. Domain d4fxva_: 4fxv A: [221592]
   automated match to d2cpja1

Details for d4fxva_

PDB Entry: 4fxv, 1.9 Å

PDB Description: crystal structure of an elav-like protein 1 (elavl1) from homo sapiens at 1.90 a resolution

PDB Compounds: (A:) ELAV-like protein 1

SCOPe Domain Sequences for d4fxva_:

Sequence; same for both SEQRES and ATOM records:

>d4fxva_ d.58.7.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
yfqgtnlivnylpqnmtqdelrslfssigevesaklirdkvaghslgygfvnyvtakdae
raintlnglrlqsktikvsyarps

Timeline for d4fxva_:

• d4fxva_ is new in SCOPe 2.03-stable
  
• d4fxva_ appears in SCOPe 2.04
  
• d4fxva_ appears in the current release, SCOPe 2.08, called d4fxva1