SCOPe 2.02: Domain d1f4hb2: 1f4h B:626-730

Lineage for d1f4hb2 (1f4h B:626-730)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (1 family)

5. Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (4 proteins)

6. Protein beta-Galactosidase, domains 2 and 4 [49305] (2 species)

7. Species Escherichia coli [TaxId:562] [49306] (25 PDB entries)
   Uniprot P00722

8. Domain d1f4hb2: 1f4h B:626-730 [22156]
   Other proteins in same PDB: d1f4ha3, d1f4ha4, d1f4ha5, d1f4hb3, d1f4hb4, d1f4hb5, d1f4hc3, d1f4hc4, d1f4hc5, d1f4hd3, d1f4hd4, d1f4hd5
   complexed with mg

Details for d1f4hb2

PDB Entry: 1f4h, 2.8 Å

PDB Description: e. coli (lacz) beta-galactosidase (orthorhombic)

PDB Compounds: (B:) beta-galactosidase

SCOPe Domain Sequences for d1f4hb2:

Sequence; same for both SEQRES and ATOM records:

>d1f4hb2 b.1.4.1 (B:626-730) beta-Galactosidase, domains 2 and 4 {Escherichia coli [TaxId: 562]}
ffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgevpldvapqgkqlielpel
pqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsvtl

Timeline for d1f4hb2:

• d1f4hb2 first appeared (with stable ids) in SCOP 1.55
  
• d1f4hb2 appears in SCOPe 2.01
  
• d1f4hb2 appears in SCOPe 2.03
  
• d1f4hb2 appears in the current release, SCOPe 2.08