Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (10 families) |
Family d.142.1.0: automated matches [227184] (1 protein) not a true family |
Protein automated matches [226904] (27 species) not a true protein |
Species Enterococcus faecalis [TaxId:1351] [226474] (1 PDB entry) |
Domain d4fu0a2: 4fu0 A:139-348 [221520] Other proteins in same PDB: d4fu0a1, d4fu0b1 automated match to d1e4ea2 complexed with adp, so4 |
PDB Entry: 4fu0 (more details), 2.35 Å
SCOPe Domain Sequences for d4fu0a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4fu0a2 d.142.1.0 (A:139-348) automated matches {Enterococcus faecalis [TaxId: 1351]} dkdrahklvslagisvpksvtfkrfneeaamkeieanltyplfikpvragssfgitkvie kqeldaaielafehdteviveetingfevgcavlgidelivgrvdeielssgffdyteky tlksskiymparidaeaekriqeaavtiykalgcsgfsrvdmfytpsgeivfnevntipg ftshsrypnmmkgiglsfsqmldkliglyv
Timeline for d4fu0a2: