Lineage for d4fu0a2 (4fu0 A:139-348)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1432977Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 1432978Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (10 families) (S)
  5. 1433300Family d.142.1.0: automated matches [227184] (1 protein)
    not a true family
  6. 1433301Protein automated matches [226904] (18 species)
    not a true protein
  7. 1433326Species Enterococcus faecalis [TaxId:1351] [226474] (1 PDB entry)
  8. 1433327Domain d4fu0a2: 4fu0 A:139-348 [221520]
    Other proteins in same PDB: d4fu0a1, d4fu0b1
    automated match to d1e4ea2
    complexed with adp, so4

Details for d4fu0a2

PDB Entry: 4fu0 (more details), 2.35 Å

PDB Description: Crystal Structure of VanG D-Ala:D-Ser Ligase from Enterococcus faecalis
PDB Compounds: (A:) D-alanine--D-alanine ligase 7

SCOPe Domain Sequences for d4fu0a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fu0a2 d.142.1.0 (A:139-348) automated matches {Enterococcus faecalis [TaxId: 1351]}
dkdrahklvslagisvpksvtfkrfneeaamkeieanltyplfikpvragssfgitkvie
kqeldaaielafehdteviveetingfevgcavlgidelivgrvdeielssgffdyteky
tlksskiymparidaeaekriqeaavtiykalgcsgfsrvdmfytpsgeivfnevntipg
ftshsrypnmmkgiglsfsqmldkliglyv

SCOPe Domain Coordinates for d4fu0a2:

Click to download the PDB-style file with coordinates for d4fu0a2.
(The format of our PDB-style files is described here.)

Timeline for d4fu0a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4fu0a1