Lineage for d4fssa_ (4fss A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2782861Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2783360Family b.34.2.0: automated matches [191375] (1 protein)
    not a true family
  6. 2783361Protein automated matches [190457] (10 species)
    not a true protein
  7. 2783437Species Human (Homo sapiens) [TaxId:9606] [187598] (105 PDB entries)
  8. 2783530Domain d4fssa_: 4fss A: [221499]
    automated match to d3i35a_
    complexed with cl, gol, po4

Details for d4fssa_

PDB Entry: 4fss (more details), 2.25 Å

PDB Description: crystal structure of a ras p21 protein activator (rasa1) from homo sapiens at 2.25 a resolution
PDB Compounds: (A:) Ras GTPase-activating protein 1

SCOPe Domain Sequences for d4fssa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fssa_ b.34.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rrrvrailpytkvpdtdeisflkgdmfivhneledgwmwvtnlrtdeqglivedlveevg

SCOPe Domain Coordinates for d4fssa_:

Click to download the PDB-style file with coordinates for d4fssa_.
(The format of our PDB-style files is described here.)

Timeline for d4fssa_: