SCOPe 2.08: Domain d4fska1: 4fsk A:1-136

Lineage for d4fska1 (4fsk A:1-136)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.96: T-fold [55619] (2 superfamilies)
   beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234
   tunnel-shaped: its known members form wide oligomeric barrels different sizes

4. Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (5 families)
   bind purine or pterin in topologically similar sites between subunits

5. Family d.96.1.4: Urate oxidase (uricase) [55633] (2 proteins)
   automatically mapped to Pfam PF01014

6. Protein Urate oxidase (uricase) [55634] (3 species)
   duplication: one subunit consists of two domains of this fold; beta-sheets of two subunits form a barrel, closed: n=16, S=16

7. Species Aspergillus flavus [TaxId:5059] [55635] (71 PDB entries)

8. Domain d4fska1: 4fsk A:1-136 [221495]
   automated match to d1r4ua1
   complexed with ace, azi, na

Details for d4fska1

PDB Entry: 4fsk, 1.98 Å

PDB Description: urate oxidase-azide complex in anaerobic conditions

PDB Compounds: (A:) Uricase

SCOPe Domain Sequences for d4fska1:

Sequence; same for both SEQRES and ATOM records:

>d4fska1 d.96.1.4 (A:1-136) Urate oxidase (uricase) {Aspergillus flavus [TaxId: 5059]}
savkaarygkdnvrvykvhkdektgvqtvyemtvcvllegeietsytkadnsvivatdsi
kntiyitakqnpvtppelfgsilgthfiekynhihaahvnivchrwtrmdidgkphphsf
irdseekrnvqvdvve

Timeline for d4fska1:

• d4fska1 first appeared in SCOPe 2.03
  
• d4fska1 appears in SCOPe 2.07