Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (9 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187221] (385 PDB entries) |
Domain d4fqxd2: 4fqx D:94-193 [221473] Other proteins in same PDB: d4fqxa1, d4fqxa2, d4fqxb1, d4fqxc1, d4fqxd1 automated match to d1hdmb1 |
PDB Entry: 4fqx (more details), 2.6 Å
SCOPe Domain Sequences for d4fqxd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4fqxd2 b.1.1.2 (D:94-193) automated matches {Human (Homo sapiens) [TaxId: 9606]} trppsvqvakttpfntrepvmlacyvwgfypaevtitwrkngklvmphssahktaqpngd wtyqtlshlaltpsygdtytcvvehigapepilrdwtpgl
Timeline for d4fqxd2: