SCOPe 2.04: Domain d4fqxd2: 4fqx D:94-193

Lineage for d4fqxd2 (4fqx D:94-193)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (9 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (385 PDB entries)

8. Domain d4fqxd2: 4fqx D:94-193 [221473]
   Other proteins in same PDB: d4fqxa1, d4fqxa2, d4fqxb1, d4fqxc1, d4fqxd1
   automated match to d1hdmb1

Details for d4fqxd2

PDB Entry: 4fqx, 2.6 Å

PDB Description: crystal structure of hla-dm bound to hla-dr1

PDB Compounds: (D:) HLA class II histocompatibility antigen, DM beta chain

SCOPe Domain Sequences for d4fqxd2:

Sequence; same for both SEQRES and ATOM records:

>d4fqxd2 b.1.1.2 (D:94-193) automated matches {Human (Homo sapiens) [TaxId: 9606]}
trppsvqvakttpfntrepvmlacyvwgfypaevtitwrkngklvmphssahktaqpngd
wtyqtlshlaltpsygdtytcvvehigapepilrdwtpgl

Timeline for d4fqxd2:

• d4fqxd2 first appeared in SCOPe 2.03
  
• d4fqxd2 appears in SCOPe 2.05
  
• d4fqxd2 appears in the current release, SCOPe 2.08