![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
![]() | Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) ![]() |
![]() | Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
![]() | Protein automated matches [191280] (4 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [189896] (32 PDB entries) |
![]() | Domain d4fqxd1: 4fqx D:3-93 [221472] Other proteins in same PDB: d4fqxa1, d4fqxa2, d4fqxb2, d4fqxb3, d4fqxc2, d4fqxc3, d4fqxd2 automated match to d1hdmb2 |
PDB Entry: 4fqx (more details), 2.6 Å
SCOPe Domain Sequences for d4fqxd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4fqxd1 d.19.1.1 (D:3-93) automated matches {Human (Homo sapiens) [TaxId: 9606]} fvahvestcllddagtpkdftycisfnkdlltcwdpeenkmapsefgvlnslanvlsqhl nqkdtlmqrlrnglqncathtqpfwgsltdr
Timeline for d4fqxd1: