SCOPe 2.03: Domain d4fqxc2: 4fqx C:97-200

Lineage for d4fqxc2 (4fqx C:97-200)

Root: SCOPe 2.03
Class b: All beta proteins [48724] (174 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein automated matches [190374] (12 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [187221] (293 PDB entries)
Domain d4fqxc2: 4fqx C:97-200 [221471]
Other proteins in same PDB: d4fqxa1, d4fqxa2, d4fqxb1, d4fqxc1, d4fqxd1
automated match to d1hdma1

Details for d4fqxc2

PDB Entry: 4fqx (more details), 2.6 Å

PDB Description: crystal structure of hla-dm bound to hla-dr1

PDB Compounds: (C:) HLA class II histocompatibility antigen, DM alpha chain

SCOPe Domain Sequences for d4fqxc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fqxc2 b.1.1.2 (C:97-200) automated matches {Human (Homo sapiens) [TaxId: 9606]}
srgfpiaevftlkplefgkpntlvcfvsnlfppmltvnwqhhsvpvegfgptfvsavdgl
sfqafsyldftpepsdifscivtheidrytaiaywvprnalpsl

SCOPe Domain Coordinates for d4fqxc2:

Click to download the PDB-style file with coordinates for d4fqxc2.
(The format of our PDB-style files is described here.)

Timeline for d4fqxc2: