Lineage for d4fqxc1 (4fqx C:15-96)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1405985Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1405986Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 1405987Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1406849Protein automated matches [191280] (4 species)
    not a true protein
  7. 1406858Species Human (Homo sapiens) [TaxId:9606] [189896] (19 PDB entries)
  8. 1406880Domain d4fqxc1: 4fqx C:15-96 [221470]
    Other proteins in same PDB: d4fqxa1, d4fqxa2, d4fqxb2, d4fqxc2, d4fqxd2
    automated match to d1hdma2

Details for d4fqxc1

PDB Entry: 4fqx (more details), 2.6 Å

PDB Description: crystal structure of hla-dm bound to hla-dr1
PDB Compounds: (C:) HLA class II histocompatibility antigen, DM alpha chain

SCOPe Domain Sequences for d4fqxc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fqxc1 d.19.1.1 (C:15-96) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nhtflhtvycqdgspsvglseaydedqlfffdfsqntrvprlpefadwaqeqgdapailf
dkefcewmiqqigpkldgkipv

SCOPe Domain Coordinates for d4fqxc1:

Click to download the PDB-style file with coordinates for d4fqxc1.
(The format of our PDB-style files is described here.)

Timeline for d4fqxc1: