Lineage for d1f4ab1 (1f4a B:220-333)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) 
Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (4 proteins) 
Protein beta-Galactosidase, domains 2 and 4 [49305] (3 species) Species Escherichia coli [TaxId:562] [49306] (46 PDB entries)
Uniprot P00722
Domain d1f4ab1: 1f4a B:220-333 [22147]
Other proteins in same PDB: d1f4aa3, d1f4aa4, d1f4aa5, d1f4ab3, d1f4ab4, d1f4ab5, d1f4ac3, d1f4ac4, d1f4ac5, d1f4ad3, d1f4ad4, d1f4ad5
complexed with mg
Details for d1f4ab1
PDB Entry: 1f4a (more details), 2.8 Å
PDB Description: e. coli (lacz) beta-galactosidase (ncs constrained monomer- orthorhombic)
PDB Compounds: (B:) beta-galactosidaseSCOPe Domain Sequences for d1f4ab1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f4ab1 b.1.4.1 (B:220-333) beta-Galactosidase, domains 2 and 4 {Escherichia coli [TaxId: 562]}
tqisdfhvatrfnddfsravleaevqmcgelrdylrvtvslwqgetqvasgtapfggeii
derggyadrvtlrlnvenpklwsaeipnlyravvelhtadgtlieaeacdvgfr
SCOPe Domain Coordinates for d1f4ab1:
Click to download the PDB-style file with coordinates for d1f4ab1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1f4ab1:
- d1f4ab1 first appeared (with stable ids) in SCOP 1.55
- d1f4ab1 appears in SCOPe 2.07
 View in 3DDomains from same chain: (mouse over for more information) d1f4ab2, d1f4ab3, d1f4ab4, d1f4ab5 |
