SCOPe 2.07: Domain d4fqxa2: 4fqx A:82-181

Lineage for d4fqxa2 (4fqx A:82-181)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)

8. Domain d4fqxa2: 4fqx A:82-181 [221467]
   Other proteins in same PDB: d4fqxa1, d4fqxb1, d4fqxb2, d4fqxb3, d4fqxc1, d4fqxc2, d4fqxc3, d4fqxd1, d4fqxd2
   automated match to d1ieaa1
   complexed with nag

Details for d4fqxa2

PDB Entry: 4fqx, 2.6 Å

PDB Description: crystal structure of hla-dm bound to hla-dr1

PDB Compounds: (A:) hla class II histocompatibility antigen, dr alpha chain

SCOPe Domain Sequences for d4fqxa2:

Sequence; same for both SEQRES and ATOM records:

>d4fqxa2 b.1.1.0 (A:82-181) automated matches {Human (Homo sapiens) [TaxId: 9606]}
itnvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvttgvsetvflpre
dhlfrkfhylpflpstedvydcrvehwgldepllkhwefd

Timeline for d4fqxa2:

• d4fqxa2 first appeared in SCOPe 2.03
  
• d4fqxa2 appears in SCOPe 2.06
  
• d4fqxa2 appears in the current release, SCOPe 2.08